6f45/1/1:A/1:C

Sequences
>6f45-a1-m1-cA (length=68) [Search sequence]
SASIAIGDNDTGLRWGGDGIVQIVANNAIVGGWNSTDIFTEAGKHITSNGNLNQWGGGAI
YCRDLNVS
>6f45-a1-m1-cC (length=69) [Search sequence]
GSASIAIGDNDTGLRWGGDGIVQIVANNAIVGGWNSTDIFTEAGKHITSNGNLNQWGGGA
IYCRDLNVS
Structure information
PDB ID 6f45 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the gp37-gp38 adhesin tip complex of the bacteriophage S16 long tail fiber
Assembly ID 1
Resolution 1.70356Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 147
Sequence identity between the two chains 1.0
PubMed citation 30244968
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession M1EAS5 M1EAS5
Species 1087482 (Salmonella phage vB_SenM-S16) 1087482 (Salmonella phage vB_SenM-S16)
Function annotation BioLiP:6f45A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6f45-a1-m1-cA_6f45-a1-m1-cC.pdb.gz
Full biological assembly
Download: 6f45-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6f45/1/1:A/1:B 6f45/1/1:C/1:B

[Back to Home]