6f5n/1/1:A/1:B

Sequences
>6f5n-a1-m1-cA (length=56) [Search sequence]
MQFKLILNGKTLKGVITIEAVDHAEAEKFFKQYANDNGVDGEWTYDEATHTFTVTE
>6f5n-a1-m1-cB (length=56) [Search sequence]
MQFKLILNGKTLKGVITIEAVDHAEAEKFFKQYANDNGVDGEWTYDEATHTFTVTE
Structure information
PDB ID 6f5n (database links: RCSB PDB PDBe PDBj PDBsum)
Title Nickel-Bound Crystal Structure of a GB1 Variant
Assembly ID 1
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession
Species 1301 (Streptococcus) 1301 (Streptococcus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6f5n-a1-m1-cA_6f5n-a1-m1-cB.pdb.gz
Full biological assembly
Download: 6f5n-assembly1.cif.gz

[Back to Home]