6f9w/1/1:B/2:B

Sequences
>6f9w-a1-m1-cB (length=30) [Search sequence]
GLAKWFGSDLQQPLPSPAKVISVDELEYRQ
>6f9w-a1-m2-cB (length=30) [Search sequence]
GLAKWFGSDLQQPLPSPAKVISVDELEYRQ
Structure information
PDB ID 6f9w (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the LSM domain of LSM14 in complex with a C-terminal peptide of 4E-T
Assembly ID 1
Resolution 2.623Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 11
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession Q9NRA8 Q9NRA8
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6f9w-a1-m1-cB_6f9w-a1-m2-cB.pdb.gz
Full biological assembly
Download: 6f9w-assembly1.cif.gz

[Back to Home]