6fbq/1/1:A/1:B

Sequences

>6fbq-a1-m1-cA (length=80) [Search sequence]

FTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQY CRYQKCLAMGMKREAVQEER

>6fbq-a1-m1-cB (length=81) [Search sequence]

TKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYC RYQKCLAMGMKREAVQEERQR

Structure information

PDB ID	6fbq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the Human Retinoid X Receptor DNA-Binding Domain Bound to the Human MEp DR1 Response Element, pH 7.0
Assembly ID	1
Resolution	1.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	14
Sequence identity between the two chains	0.988
PubMed citation	30476562

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P19793	P19793
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:6fbqA	BioLiP:6fbqB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6fbq-a1-m1-cA_6fbq-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6fbq-assembly1.cif.gz

Similar dimers