6fd5/1/1:B/1:A

Sequences
>6fd5-a1-m1-cB (length=171) [Search sequence]
SELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAG
LDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYAELEIQKDALEPGQRVVVVDDL
LATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
>6fd5-a1-m1-cA (length=173) [Search sequence]
DSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIA
GLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSAELEIQKDALEPGQRVVVVD
DLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
Structure information
PDB ID 6fd5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Human APRT-Tyr105Phe variant in complex with Adenine, PRPP and Mg2+, 14 days post crystallization (with AMP and PPi products partially generated)
Assembly ID 1
Resolution 1.55Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 100
Sequence identity between the two chains 1.0
PubMed citation 29576532
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P07741 P07741
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:6fd5B BioLiP:6fd5A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6fd5-a1-m1-cB_6fd5-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6fd5-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1ore/1/1:A/2:A 1zn7/1/1:A/1:B 1zn8/1/1:A/1:B 1zn9/1/1:A/1:B 4x44/1/1:A/2:A 4x45/1/1:B/1:A 6fch/1/1:A/1:B 6fci/1/1:D/1:A 6fci/2/1:B/1:C 6fcl/1/1:B/1:A 6fd4/1/1:B/1:A 6fd6/1/1:A/1:B 6hgp/1/1:B/1:A 6hgq/1/1:B/1:A 6hgq/2/1:D/1:C 6hgr/1/1:A/1:B 6hgs/1/1:B/1:A 6hgs/2/1:B/1:A

[Back to Home]