6fga/4/1:G/1:H

Sequences
>6fga-a4-m1-cG (length=77) [Search sequence]
RLTMMWEEVTCPICLDPFVEPVSIECGHSFCQECISQVGKGGGSVCPVCRQRFLLKNLRP
NRQLANMVNNLKEISQE
>6fga-a4-m1-cH (length=77) [Search sequence]
RLTMMWEEVTCPICLDPFVEPVSIECGHSFCQECISQVGKGGGSVCPVCRQRFLLKNLRP
NRQLANMVNNLKEISQE
Structure information
PDB ID 6fga (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of TRIM21 E3 ligase, RING domain in complex with its cognate E2 conjugating enzyme UBE2E1
Assembly ID 4
Resolution 2.82Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 51
Sequence identity between the two chains 1.0
PubMed citation 31160341
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G H
UniProt accession P19474 P19474
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:6fgaG BioLiP:6fgaH
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6fga-a4-m1-cG_6fga-a4-m1-cH.pdb.gz
Full biological assembly
Download: 6fga-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5olm/1/1:A/1:B 6fga/1/1:A/1:E 6fga/2/1:B/1:C 6fga/3/1:D/1:F 6s53/1/1:A/1:B 6s53/2/1:H/1:G

[Back to Home]