6fxa/3/1:E/1:F

Sequences
>6fxa-a3-m1-cE (length=35) [Search sequence]
ENIEETITVMKKLEEPRQKVVLDTAKIQLKEQDEQ
>6fxa-a3-m1-cF (length=35) [Search sequence]
ENIEETITVMKKLEEPRQKVVLDTAKIQLKEQDEQ
Structure information
PDB ID 6fxa (database links: RCSB PDB PDBe PDBj PDBsum)
Title Dimerization domain of TP901-1 CI repressor
Assembly ID 3
Resolution 1.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 82
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E F
UniProt accession O48503 O48503
Species 35345 (Lactococcus phage TP901-1) 35345 (Lactococcus phage TP901-1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6fxa-a3-m1-cE_6fxa-a3-m1-cF.pdb.gz
Full biological assembly
Download: 6fxa-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6fxa/1/1:A/1:B 6fxa/2/1:D/1:C

[Back to Home]