6gay/1/1:B/1:A

Sequences
>6gay-a1-m1-cB (length=108) [Search sequence]
EMSVVFSDPSQPDNPIIYVSDAFLVQTGYTLEEVLGRNCRFLQGPDTNPHAVEAIRQGLK
AETRFTIDILNYRKDGSAFVNRLRIRPIYDPEGNLMFFAGAQNPVLEH
>6gay-a1-m1-cA (length=110) [Search sequence]
EAEMSVVFSDPSQPDNPIIYVSDAFLVQTGYTLEEVLGRNCRFLQGPDTNPHAVEAIRQG
LKAETRFTIDILNYRKDGSAFVNRLRIRPIYDPEGNLMFFAGAQNPVLEH
Structure information
PDB ID 6gay (database links: RCSB PDB PDBe PDBj PDBsum)
Title A fast recovering full-length LOV protein (DsLOV) from the marine phototrophic bacterium Dinoroseobacter shibae (Dark state) - M49I mutant
Assembly ID 1
Resolution 1.86Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 67
Sequence identity between the two chains 1.0
PubMed citation 29989797
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession A8LP63 A8LP63
Species 398580 (Dinoroseobacter shibae DFL 12 = DSM 16493) 398580 (Dinoroseobacter shibae DFL 12 = DSM 16493)
Function annotation BioLiP:6gayB BioLiP:6gayA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6gay-a1-m1-cB_6gay-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6gay-assembly1.cif.gz

[Back to Home]