6gbq/1/1:B/1:C

Sequences
>6gbq-a1-m1-cB (length=65) [Search sequence]
LKKVEDTLTMLVNATSRQNAAIEALENRLSTLESSLKPIQDMGKVISSLNRSCAEMVAKY
DLLEH
>6gbq-a1-m1-cC (length=69) [Search sequence]
LKKVEDTLTMLVNATSRQNAAIEALENRLSTLESSLKPIQDMGKVISSLNRSCAEMVAKY
DLLEHHHHH
Structure information
PDB ID 6gbq (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the oligomerization domain of Vp35 from Reston virus
Assembly ID 1
Resolution 2.43Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 92
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession Q8JPY0 Q8JPY0
Species 186539 (Reston ebolavirus) 186539 (Reston ebolavirus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6gbq-a1-m1-cB_6gbq-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6gbq-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 6gbr/1/1:B/1:A 6gbq/1/1:B/1:A 6gbq/1/1:D/1:C 6gbr/1/1:D/1:C
  • 6gbq/2/1:H/1:F 6gbq/1/1:C/1:A
  • 6gbq/1/1:D/1:A 6gbr/1/1:A/1:D
  • [Back to Home]