6gbu/1/1:E/1:G

Sequences
>6gbu-a1-m1-cE (length=42) [Search sequence]
VKALYDYEGQTDDELSFPEGAIIRILWEGEFNGRIGVFPSVL
>6gbu-a1-m1-cG (length=54) [Search sequence]
VKALYDYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEFNGRIGVFPSVLVE
Structure information
PDB ID 6gbu (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the second SH3 domain of FCHSD2 (SH3-2) in complex with the fourth SH3 domain of ITSN1 (SH3d)
Assembly ID 1
Resolution 3.44Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 21
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E G
UniProt accession O94868 O94868
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6gbu-a1-m1-cE_6gbu-a1-m1-cG.pdb.gz
Full biological assembly
Download: 6gbu-assembly1.cif.gz

[Back to Home]