6gbu/1/1:H/1:D

Sequences

>6gbu-a1-m1-cH (length=63) [Search sequence]

PEIAQVIASYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKL LSP

>6gbu-a1-m1-cD (length=64) [Search sequence]

KPEIAQVIASYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVK LLSP

Structure information

PDB ID	6gbu (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the second SH3 domain of FCHSD2 (SH3-2) in complex with the fourth SH3 domain of ITSN1 (SH3d)
Assembly ID	1
Resolution	3.44Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	11
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	H	D
UniProt accession	Q15811	Q15811
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6gbu-a1-m1-cH_6gbu-a1-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6gbu-assembly1.cif.gz

Similar dimers