6gbv/1/1:A/2:A

Sequences
>6gbv-a1-m1-cA (length=120) [Search sequence]
DIADLRALLDEDEAEMSVVFSDPSQPDNPTIYVSDAFLVQTGYTLEEVLGRNCRFLQGPD
TNPHAVEAIRQGLKAETRFTIDILNYRKDGSAFVNRLRIRPIYDPEGNLMFFAGAQNPVL
>6gbv-a1-m2-cA (length=120) [Search sequence]
DIADLRALLDEDEAEMSVVFSDPSQPDNPTIYVSDAFLVQTGYTLEEVLGRNCRFLQGPD
TNPHAVEAIRQGLKAETRFTIDILNYRKDGSAFVNRLRIRPIYDPEGNLMFFAGAQNPVL
Structure information
PDB ID 6gbv (database links: RCSB PDB PDBe PDBj PDBsum)
Title A fast recovering full-length LOV protein (DsLOV) from the marine phototrophic bacterium Dinoroseobacter shibae (Dark state) - M49T mutant
Assembly ID 1
Resolution 1.63Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 64
Sequence identity between the two chains 1.0
PubMed citation 29989797
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession A8LP63 A8LP63
Species 398580 (Dinoroseobacter shibae DFL 12 = DSM 16493) 398580 (Dinoroseobacter shibae DFL 12 = DSM 16493)
Function annotation BioLiP:6gbvA BioLiP:6gbvA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6gbv-a1-m1-cA_6gbv-a1-m2-cA.pdb.gz
Full biological assembly
Download: 6gbv-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4kuk/1/1:A/2:A 4kuo/1/1:A/2:A 6gb3/1/1:A/2:A 6gba/1/1:A/2:A 7zqu/1/1:A/2:A

[Back to Home]