6giw/1/1:B/1:C

Sequences
>6giw-a1-m1-cB (length=155) [Search sequence]
EEPVKDTNGNPLKIETRYFIQPASGGGLVPANVDLSHLCPLGIVRTSLPYQPGLPVTIST
PNDVLTNTNIAITFDAPIWPCPSSKTWTVDSSSEEKYIITGGDPKSGESFFRIEKYGNGK
NTYKLVGKSVGSTKSLWGPALVLNDAFPIKFREVD
>6giw-a1-m1-cC (length=157) [Search sequence]
EPVKDTNGNPLKIETRYFIQPASGGGLVPANVDLSHLCPLGIVRTSLPYQPGLPVTISTP
NDVLTNTNIAITFDAPIWPCPSSKTWTVDSSSEEKYIITGGDPKSGESFFRIEKYGNGKN
TYKLVRYGKSVGSTKSLWGPALVLNDNAFPIKFREVD
Structure information
PDB ID 6giw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Water-soluble Chlorophyll Protein (WSCP) from Lepidium virginicum (Mutation L91P) with Chlorophyll-a
Assembly ID 1
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 32
Sequence identity between the two chains 0.994
PubMed citation 30297830
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession O04797 O04797
Species 59292 (Lepidium virginicum) 59292 (Lepidium virginicum)
Function annotation BioLiP:6giwB BioLiP:6giwC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6giw-a1-m1-cB_6giw-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6giw-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2dre/1/1:A/1:D 2dre/1/1:B/1:C 6giw/1/1:A/1:D 6gix/1/1:A/1:D 6gix/1/1:B/1:C 6s2y/1/1:A/1:D 6s2y/1/1:B/1:C
Other dimers with similar sequences but different poses
  • 2dre/1/1:C/1:D 6giw/1/1:B/1:A 6giw/1/1:C/1:D 6gix/1/1:A/1:B 6gix/1/1:C/1:D 6s2y/1/1:A/1:B 6s2y/1/1:C/1:D
    		•

    [Back to Home]