6gjw/2/1:B/1:C

Sequences
>6gjw-a2-m1-cB (length=78) [Search sequence]
EEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAV
GRHRKVSPNCRFINGFYL
>6gjw-a2-m1-cC (length=78) [Search sequence]
EEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAV
GRHRKVSPNCRFINGFYL
Structure information
PDB ID 6gjw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of XIAP-BIR1 domain in complex with an NF023 analog
Assembly ID 2
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 22
Sequence identity between the two chains 1.0
PubMed citation 31011505
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession P98170 P98170
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:6gjwB BioLiP:6gjwC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6gjw-a2-m1-cB_6gjw-a2-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6gjw-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4mtz/1/1:C/1:A 4mtz/2/1:B/1:D 6gjw/1/1:A/1:D

[Back to Home]