6gjw/2/1:B/1:C

Sequences

>6gjw-a2-m1-cB (length=78) [Search sequence]

EEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAV GRHRKVSPNCRFINGFYL

>6gjw-a2-m1-cC (length=78) [Search sequence]

EEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAV GRHRKVSPNCRFINGFYL

Structure information

PDB ID	6gjw (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of XIAP-BIR1 domain in complex with an NF023 analog
Assembly ID	2
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	22
Sequence identity between the two chains	1.0
PubMed citation	31011505

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	P98170	P98170
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:6gjwB	BioLiP:6gjwC

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6gjw-a2-m1-cB_6gjw-a2-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6gjw-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4mtz/1/1:C/1:A 4mtz/2/1:B/1:D 6gjw/1/1:A/1:D