6gno/1/2:A/2:B

Sequences
>6gno-a1-m2-cA (length=114) [Search sequence]
CPLMVKILDAVKGTPAGSVALKVSQKTADGGWTQIATGVTDATGEIHNLITEQQFPAGVY
RVEFDTKAYWTNQGSTPFHEVAEVVFDAHPEGHRHYTLALLLSPFSYTTTAVVS
>6gno-a1-m2-cB (length=114) [Search sequence]
CPLMVKILDAVKGTPAGSVALKVSQKTADGGWTQIATGVTDATGEIHNLITEQQFPAGVY
RVEFDTKAYWTNQGSTPFHEVAEVVFDAHPEGHRHYTLALLLSPFSYTTTAVVS
Structure information
PDB ID 6gno (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure Of Sea Bream Transthyretin in complex with Tetrabromobisphenol A (TBBPA)
Assembly ID 1
Resolution 1.65Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 52
Sequence identity between the two chains 1.0
PubMed citation 30226982
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession Q9PTT3 Q9PTT3
Species 8175 (Sparus aurata) 8175 (Sparus aurata)
Function annotation BioLiP:6gnoA BioLiP:6gnoB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6gno-a1-m2-cA_6gno-a1-m2-cB.pdb.gz
Full biological assembly
Download: 6gno-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1oo2/1/1:A/1:B 1oo2/1/1:C/1:D 1sn0/1/1:B/1:A 1sn0/1/1:D/1:C 1sn2/1/1:B/1:A 1sn2/1/1:D/1:C 1sn5/1/1:B/1:A 1sn5/1/1:D/1:C 6gnm/1/1:B/1:A 6gnm/1/1:C/1:D 6gno/1/1:A/1:B 6gnp/1/1:A/1:B 6gnp/1/1:C/1:D 6gnr/1/1:B/1:A 6gnr/1/2:B/2:A 6gnw/1/1:A/1:B 6gnw/1/1:C/1:D 6gon/1/1:A/1:B 6gon/1/1:C/1:D 6goo/1/1:A/1:B 6goo/1/2:A/2:B
Other dimers with similar sequences but different poses
  • 6gno/1/1:A/2:A 1oo2/1/1:A/1:C 1oo2/1/1:B/1:D 1sn0/1/1:C/1:A 1sn0/1/1:D/1:B 1sn2/1/1:C/1:A 1sn2/1/1:D/1:B 1sn5/1/1:C/1:A 1sn5/1/1:D/1:B 6gnm/1/1:B/1:D 6gnm/1/1:C/1:A 6gno/1/1:B/2:B 6gnp/1/1:A/1:C 6gnp/1/1:D/1:B 6gnr/1/1:A/2:A 6gnr/1/1:B/2:B 6gnw/1/1:A/1:C 6gnw/1/1:D/1:B 6gon/1/1:A/1:C 6gon/1/1:B/1:D 6goo/1/1:A/2:A 6goo/1/1:B/2:B
  • 6gno/1/1:A/2:B 1oo2/1/1:A/1:D 1oo2/1/1:B/1:C 1sn0/1/1:C/1:B 1sn0/1/1:D/1:A 1sn2/1/1:C/1:B 1sn2/1/1:D/1:A 1sn5/1/1:C/1:B 1sn5/1/1:D/1:A 6gnm/1/1:B/1:C 6gnm/1/1:D/1:A 6gno/1/1:B/2:A 6gnp/1/1:A/1:D 6gnp/1/1:C/1:B 6gnr/1/1:B/2:A 6gnr/1/2:B/1:A 6gnw/1/1:A/1:D 6gnw/1/1:C/1:B 6gon/1/1:A/1:D 6gon/1/1:B/1:C 6goo/1/1:A/2:B 6goo/1/1:B/2:A
  • [Back to Home]