6gp7/1/1:A/1:B

Sequences
>6gp7-a1-m1-cA (length=58) [Search sequence]
KVKLSAKEILEKEFKTGVRGYKQEDVDKFLDMIIKDYETFHQEIEELQQENLQLKKQL
>6gp7-a1-m1-cB (length=59) [Search sequence]
KVKLSAKEILEKEFKTGVRGYKQEDVDKFLDMIIKDYETFHQEIEELQQENLQLKKQLE
Structure information
PDB ID 6gp7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Cell division regulator, B. subtilis GpsB, in complex with peptide fragment of Penicillin Binding Protein PBP1A
Assembly ID 1
Resolution 1.95002Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 107
Sequence identity between the two chains 1.0
PubMed citation 30651563
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P0CI74 P0CI74
Species 224308 (Bacillus subtilis subsp. subtilis str. 168) 224308 (Bacillus subtilis subsp. subtilis str. 168)
Function annotation BioLiP:6gp7B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6gp7-a1-m1-cA_6gp7-a1-m1-cB.pdb.gz
Full biological assembly
Download: 6gp7-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4ug3/1/1:B/1:A 4ug3/2/1:D/1:C 6gpz/1/1:B/1:A

[Back to Home]