6gqa/1/1:C/1:B

Sequences
>6gqa-a1-m1-cC (length=58) [Search sequence]
GAIIFSAKDIFEQEFGREVRGYNKVEVDEFLDDVIKDYETYAALVKSLRQEIADLKEE
>6gqa-a1-m1-cB (length=60) [Search sequence]
GAIIFSAKDIFEQEFGREVRGYNKVEVDEFLDDVIKDYETYAALVKSLRQEIADLKEELT
Structure information
PDB ID 6gqa (database links: RCSB PDB PDBe PDBj PDBsum)
Title Cell division regulator S. pneumoniae GpsB
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 16
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C B
UniProt accession Q8DR57 Q8DR57
Species 171101 (Streptococcus pneumoniae R6) 171101 (Streptococcus pneumoniae R6)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6gqa-a1-m1-cC_6gqa-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6gqa-assembly1.cif.gz

[Back to Home]