6gqa/1/1:C/1:D

Sequences
>6gqa-a1-m1-cC (length=58) [Search sequence]
GAIIFSAKDIFEQEFGREVRGYNKVEVDEFLDDVIKDYETYAALVKSLRQEIADLKEE
>6gqa-a1-m1-cD (length=58) [Search sequence]
GAIIFSAKDIFEQEFGREVRGYNKVEVDEFLDDVIKDYETYAALVKSLRQEIADLKEE
Structure information
PDB ID 6gqa (database links: RCSB PDB PDBe PDBj PDBsum)
Title Cell division regulator S. pneumoniae GpsB
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 106
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q8DR57 Q8DR57
Species 171101 (Streptococcus pneumoniae R6) 171101 (Streptococcus pneumoniae R6)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6gqa-a1-m1-cC_6gqa-a1-m1-cD.pdb.gz
Full biological assembly
Download: 6gqa-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6gqa/1/1:A/1:B 6gqn/1/1:A/1:B

[Back to Home]