6gu1/1/1:A/1:B

Sequences
>6gu1-a1-m1-cA (length=55) [Search sequence]
AAWRINYRAWYKAKLTPTQVKTVLGVSQAEMNNVAKQLQRLYLGYYSFYTAMEKK
>6gu1-a1-m1-cB (length=55) [Search sequence]
AAWRINYRAWYKAKLTPTQVKTVLGVSQAEMNNVAKQLQRLYLGYYSFYTAMEKK
Structure information
PDB ID 6gu1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title SFI3 effector protein from the oomycete plant pathogen Phytophthora infestans
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 77
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession D0N6D2 D0N6D2
Species 403677 (Phytophthora infestans T30-4) 403677 (Phytophthora infestans T30-4)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6gu1-a1-m1-cA_6gu1-a1-m1-cB.pdb.gz
Full biological assembly
Download: 6gu1-assembly1.cif.gz

[Back to Home]