6gyg/1/1:A/1:B

Sequences
>6gyg-a1-m1-cA (length=59) [Search sequence]
RKNIKLTEPIFNKLKALMKVKDVKQYELIEIILDFYVTNKLSEKEREFFNYQLEELRKE
>6gyg-a1-m1-cB (length=61) [Search sequence]
FRKNIKLTEPIFNKLKALMKVKDVKQYELIEIILDFYVTNKLSEKEREFFNYQLEELRKE
E
Structure information
PDB ID 6gyg (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray structure of the apo form of the establishement gene regulator Reg576 of the G+ plasmid p576
Assembly ID 1
Resolution 1.98Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 126
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession
Species 293387 (Bacillus altitudinis) 293387 (Bacillus altitudinis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6gyg-a1-m1-cA_6gyg-a1-m1-cB.pdb.gz
Full biological assembly
Download: 6gyg-assembly1.cif.gz

[Back to Home]