6gzx/1/1:W4/1:X3

Sequences
>6gzx-a1-m1-cW4 (length=57) [Search sequence]
PRIVRVKRFEMKPMDPEEAAFQMEALGHSFFVFRNAKTDEINVIYRRKDGNYGLIEP
>6gzx-a1-m1-cX3 (length=57) [Search sequence]
PRIVRVKRFEMKPMDPEEAAFQMEALGHSFFVFRNAKTDEINVIYRRKDGNYGLIEP
Structure information
PDB ID 6gzx (database links: RCSB PDB PDBe PDBj PDBsum)
Title T. thermophilus hibernating 100S ribosome (ice)
Assembly ID 1
Resolution 4.57Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 175
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID W4 X3
UniProt accession Q5SIS0 Q5SIS0
Species 300852 (Thermus thermophilus HB8) 300852 (Thermus thermophilus HB8)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6gzx-a1-m1-cW4_6gzx-a1-m1-cX3.pdb.gz
Full biological assembly
Download: 6gzx-assembly1.cif.gz

[Back to Home]