6gzx/1/1:W4/1:X3

Sequences

>6gzx-a1-m1-cW4 (length=57) [Search sequence]

PRIVRVKRFEMKPMDPEEAAFQMEALGHSFFVFRNAKTDEINVIYRRKDGNYGLIEP

>6gzx-a1-m1-cX3 (length=57) [Search sequence]

PRIVRVKRFEMKPMDPEEAAFQMEALGHSFFVFRNAKTDEINVIYRRKDGNYGLIEP

Structure information

PDB ID	6gzx (database links: RCSB PDB PDBe PDBj PDBsum)
Title	T. thermophilus hibernating 100S ribosome (ice)
Assembly ID	1
Resolution	4.57Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	175
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	W4	X3
UniProt accession	Q5SIS0	Q5SIS0
Species	300852 (Thermus thermophilus HB8)	300852 (Thermus thermophilus HB8)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 6gzx-a1-m1-cW4_6gzx-a1-m1-cX3.pdb.gz

Full biological assembly Download: 6gzx-assembly1.cif.gz