6h7b/1/1:C/1:A

Sequences

>6h7b-a1-m1-cC (length=77) [Search sequence]

LPPITPQELESMSPQEQRAALGDRLFLKVYEIAPELAPKITGMFLEMKPKEAYELLNDQK RLEERVTEALCVLKAHQ

>6h7b-a1-m1-cA (length=78) [Search sequence]

LPPITPQELESMSPQEQRAALGDRLFLKVYEIAPELAPKITGMFLEMKPKEAYELLNDQK RLEERVTEALCVLKAHQT

Structure information

PDB ID	6h7b (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of Leishmania PABP1 (domain J) complexed with a peptide containing the PAM2 motif of eIF4E4.
Assembly ID	1
Resolution	1.89Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	22
Sequence identity between the two chains	1.0
PubMed citation	30476241

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	A
UniProt accession	E9AFX7	E9AFX7
Species	5664 (Leishmania major)	5664 (Leishmania major)
Function annotation	BioLiP:6h7bC	BioLiP:6h7bA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6h7b-a1-m1-cC_6h7b-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6h7b-assembly1.cif.gz

Similar dimers