6h9m/1/1:B/1:C

Sequences
>6h9m-a1-m1-cB (length=94) [Search sequence]
DTHALVQDLETHGFDKTQAETIVSALTALSNVSLDTIYKEMVTQAQQEITVQQLMAHLDA
IRKDMKQLEWKVEELLSKVYHLENEVARLKKLVG
>6h9m-a1-m1-cC (length=94) [Search sequence]
DTHALVQDLETHGFDKTQAETIVSALTALSNVSLDTIYKEMVTQAQQEITVQQLMAHLDA
IRKDMKQLEWKVEELLSKVYHLENEVARLKKLVG
Structure information
PDB ID 6h9m (database links: RCSB PDB PDBe PDBj PDBsum)
Title Coiled-coil domain-containing protein 90B residues 43-125 from Homo sapiens fused to a GCN4 adaptor
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 96
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession P03069 P03069
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6h9m-a1-m1-cB_6h9m-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6h9m-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6h9m/1/1:A/1:B 6h9m/1/1:A/1:C

[Back to Home]