6hee/2/1:B/1:A

Sequences

>6hee-a2-m1-cB (length=100) [Search sequence]

IENNVRVVVYIRKDVEDNSQTIEKEGQTVDYHKVYDSLKNVTFSSKEEQYEKLTEIMGDN WKIFEGDANPLYDAYIVAPNDVKTIAEDAKKIEGVSEVQD

>6hee-a2-m1-cA (length=116) [Search sequence]

LATDIENNVRVVVYIRKDVEDNSQTIEKEGQTVTNNDYHKVYDSLKNMSTVKSVTFSSKE EQYEKLTEIMGDNWKIFEGDANPLYDAYIVEANAPNDVKTIAEDAKKIEGVSEVQD

Structure information

PDB ID	6hee (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Extracellular Domain 1 (ECD1) of FtsX from S. pneumonie in complex with undecyl-maltoside
Assembly ID	2
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	38
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q04LE4	Q04LE4
Species	373153 (Streptococcus pneumoniae D39)	373153 (Streptococcus pneumoniae D39)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6hee-a2-m1-cB_6hee-a2-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6hee-assembly2.cif.gz