6hk5/2/1:C/1:B

Sequences
>6hk5-a2-m1-cC (length=61) [Search sequence]
ERGRKRLGIYLAHFLDHVEGHGEIGVQRDALAEDARLGALIDRALADAVARASLNAVLRD
L
>6hk5-a2-m1-cB (length=64) [Search sequence]
ESPERGRKRLGIYLAHFLDHVEGHGEIGVQRDALAEDARLGALIDRALADAVARASLNAV
LRDL
Structure information
PDB ID 6hk5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray structure of a truncated mutant of the metallochaperone CooJ with a high-affinity nickel-binding site
Assembly ID 2
Resolution 2.042Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 91
Sequence identity between the two chains 1.0
PubMed citation 30858174
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C B
UniProt accession P72321 P72321
Species 1085 (Rhodospirillum rubrum) 1085 (Rhodospirillum rubrum)
Function annotation BioLiP:6hk5C BioLiP:6hk5B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6hk5-a2-m1-cC_6hk5-a2-m1-cB.pdb.gz
Full biological assembly
Download: 6hk5-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6hk5/1/1:C/1:B 6hk5/1/1:E/1:G 6hk5/3/1:E/1:G 6hk5/4/1:D/1:A 6hk5/4/1:H/1:F 6hk5/5/1:D/1:A 6hk5/6/1:H/1:F
Other dimers with similar sequences but different poses
  • 6hk5/4/1:F/1:D 6hk5/1/1:C/1:G
  • [Back to Home]