6hq3/2/1:B/1:C

Sequences

>6hq3-a2-m1-cB (length=107) [Search sequence]

AQSVDIHKDQIIFSEGDAGDCAYIIEKGRVLIYLTKDKEEIPLTILGEGEIFGEMALIDN QNRSASVRALEDVRLAIVTKQQVLERVSTADKVVQLLMRVLLKRLRR

>6hq3-a2-m1-cC (length=109) [Search sequence]

QSVDIHKDQIIFSEGDAGDCAYIIEKGRVLIYLTKDKEEIPLTILGEGEIFGEMALIDNQ NRSASVRALEDVRLAIVTKQQVLERVSTADKVVQLLMRVLLKRLRRKNI

Structure information

PDB ID	6hq3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of EAL Enzyme Bd1971 - halfsite-occupied form
Assembly ID	2
Resolution	2.79Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	71
Sequence identity between the two chains	0.991
PubMed citation	31355487

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	Q6MLN6	Q6MLN6
Species	264462 (Bdellovibrio bacteriovorus HD100)	264462 (Bdellovibrio bacteriovorus HD100)
Function annotation	BioLiP:6hq3B	BioLiP:6hq3C

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6hq3-a2-m1-cB_6hq3-a2-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6hq3-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	6hq2/1/1:B/1:A 6hq3/1/1:D/1:A
Other dimers with similar sequences but different poses	6hq7/1/1:B/1:A 6hq4/1/1:B/1:A 6hq5/1/1:A/1:B