6igt/1/1:D/1:A

Sequences
>6igt-a1-m1-cD (length=116) [Search sequence]
LEVYTPKEIFVANGTQGKLTCKFKSTSGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGN
YPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPVGKTSHIRLYVVEKE
>6igt-a1-m1-cA (length=117) [Search sequence]
LEVYTPKEIFVANGTQGKLTCKFKSTSGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGN
YPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPVGKTSHIRLYVVEKE
Structure information
PDB ID 6igt (database links: RCSB PDB PDBe PDBj PDBsum)
Title MPZL1 mutant - V145G, Q146K, P147T and G148S
Assembly ID 1
Resolution 2.404Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 41
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D A
UniProt accession O95297 O95297
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6igt-a1-m1-cD_6igt-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6igt-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 6igo/1/1:A/1:C 6igo/2/1:B/1:D 6igo/3/1:E/2:F
  • [Back to Home]