6iiq/1/1:B/1:A

Sequences

>6iiq-a1-m1-cB (length=98) [Search sequence]

ARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKD LFPYKEYKDKFGKSNKRKGFNEGLWEIENNPGVKFTGY

>6iiq-a1-m1-cA (length=99) [Search sequence]

MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPK DLFPYKEYKDKFGKSNKRKGFNEGLWEIENNPGVKFTGY

Structure information

PDB ID	6iiq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Complex structure of the HRP3 PWWP domain with a 16-bp TA-rich DNA
Assembly ID	1
Resolution	1.85Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	25
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q9Y3E1	Q9Y3E1
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:6iiqB	BioLiP:6iiqA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6iiq-a1-m1-cB_6iiq-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6iiq-assembly1.cif.gz