6imq/2/1:C/1:D

Sequences
>6imq-a2-m1-cC (length=49) [Search sequence]
SRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLA
>6imq-a2-m1-cD (length=49) [Search sequence]
SRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLA
Structure information
PDB ID 6imq (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of PML B1-box multimers
Assembly ID 2
Resolution 2.06Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 43
Sequence identity between the two chains 1.0
PubMed citation 31439836
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession P29590 P29590
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:6imqC BioLiP:6imqD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6imq-a2-m1-cC_6imq-a2-m1-cD.pdb.gz
Full biological assembly
Download: 6imq-assembly2.cif.gz
Similar dimers

[Back to Home]