6ipw/2/1:C/1:D

Sequences

>6ipw-a2-m1-cC (length=221) [Search sequence]

SQRVPDESGLAQNYVLDRSDLQGLDLVWNENTGMDDMMKLMESKTKETYDHGEIFGQYCS
LAEHINVPYDIVFEYAANARSLEEWTYSIRNMKHLGGGLYRADEMIQPNTDIYIRAEAQK
GPEHGLVVYPCAWDQGHELWMRYYMTIIDSSKVLDKPGTVVLWTNCKHPYYDRSTENVPD
YIAEGRARTDRVWVGDIWPVFHAGHSIEMGNLKRILEHRFG

>6ipw-a2-m1-cD (length=221) [Search sequence]

Structure information

PDB ID	6ipw (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of CqsB2 from Streptomyces exfoliatus in complex with the product, 1-(2-hydroxypropyl)-2-methyl-carbazole-3,4-dione
Assembly ID	2
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	266
Sequence identity between the two chains	1.0
PubMed citation	31350791

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	A0A5A4PV77	A0A5A4PV77
Species	1905 (Streptomyces exfoliatus)	1905 (Streptomyces exfoliatus)
Function annotation	BioLiP:6ipwC	BioLiP:6ipwD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	6ipw-a2-m1-cC_6ipw-a2-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	6ipw-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6ipv/1/1:A/1:B 6ipv/2/1:C/1:D 6ipw/1/1:A/1:B