6iwd/1/1:B/2:B

Sequences
>6iwd-a1-m1-cB (length=49) [Search sequence]
EPQRHTMLCMCCKCEARIELVVESSADDLRAFQQLFLNTLSFVCPWCAS
>6iwd-a1-m2-cB (length=49) [Search sequence]
EPQRHTMLCMCCKCEARIELVVESSADDLRAFQQLFLNTLSFVCPWCAS
Structure information
PDB ID 6iwd (database links: RCSB PDB PDBe PDBj PDBsum)
Title The PTP domain of human PTPN14 in a complex with the CR3 domain of HPV18 E7
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 72
Sequence identity between the two chains 1.0
PubMed citation 31323018
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession P06788 P06788
Species 333761 (human papillomavirus 18) 333761 (human papillomavirus 18)
Function annotation BioLiP:6iwdB BioLiP:6iwdB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6iwd-a1-m1-cB_6iwd-a1-m2-cB.pdb.gz
Full biological assembly
Download: 6iwd-assembly1.cif.gz

[Back to Home]