6iwm/1/2:B/1:A

Sequences
>6iwm-a1-m2-cB (length=90) [Search sequence]
VTCGQVDANLAPCVPFLTQGGEPGAACCSGVKTLNGNAQSPDDRKTACNCIKAAANRYPN
LKDDAAQSLPSKCGISLNVPISRTINCDTI
>6iwm-a1-m1-cA (length=92) [Search sequence]
AVTCGQVDANLAPCVPFLTQGGEPGAACCSGVKTLNGNAQSPDDRKTACNCIKAAANRYP
NLKDDAAQSLPSKCGISLNVPISRTINCDTIS
Structure information
PDB ID 6iwm (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural insight into probable lipid transfer mechanism of non-specific lipid transfer protein via intermediate structures in Solanum melongena
Assembly ID 1
Resolution 1.98Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 49
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID B A
UniProt accession A0A247D6Y2 A0A247D6Y2
Species 4111 (Solanum melongena) 4111 (Solanum melongena)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6iwm-a1-m2-cB_6iwm-a1-m1-cA.pdb.gz
Full biological assembly
Download: 6iwm-assembly1.cif.gz
Similar dimers

[Back to Home]