6j0f/1/1:E/1:F

Sequences

>6j0f-a1-m1-cE (length=272) [Search sequence]

LNTQTIIDVNKAMDAMLRAYLNQDIAIRFDLPELDTMQSDAMVSIFLYDIHEDLQLRSAE
SRGFDVYAGRLLPGWVNIKCNYLITYWEASQPDNQAIQVMSQVLNALINNRQLAGIPGAY
TQVVPPKESLNSLGNFWQSLGNRPRLSLNYSVTVPVSLNDGQDSATPVTAVSSTVEQTAS
LSQEVVSHALRELLITELGGGEDNRLVLSKVELSAVKETMTQDMIILLSVSGITRQEYLK
EIDNIFDRWVNNAEVICGIRIESITKDNLVGI

>6j0f-a1-m1-cF (length=272) [Search sequence]

Structure information

PDB ID	6j0f (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Cryo-EM Structure of an Extracellular Contractile Injection System, PVC sheath/tube terminator in extended state
Assembly ID	1
Resolution	3.8Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	104
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	F
UniProt accession	B6VNM9	B6VNM9
Species	553480 (Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949)	553480 (Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	6j0f-a1-m1-cE_6j0f-a1-m1-cF.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	6j0f-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6j0f/1/1:A/1:B 6j0f/1/1:A/1:F 6j0f/1/1:B/1:C 6j0f/1/1:C/1:D 6j0f/1/1:D/1:E