6j3z/1/1:M/1:m

Sequences
>6j3z-a1-m1-cM (length=42) [Search sequence]
EVQFGAYLAVLLGTFLPALFLVNLFIQTEARKAGKAGGQDSD
>6j3z-a1-m1-cm (length=42) [Search sequence]
EVQFGAYLAVLLGTFLPALFLVNLFIQTEARKAGKAGGQDSD
Structure information
PDB ID 6j3z (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of C2S1M1-type PSII-FCPII supercomplex from diatom
Assembly ID 1
Resolution 3.6Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 67
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID M m
UniProt accession
Species 184592 (Chaetoceros gracilis) 184592 (Chaetoceros gracilis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6j3z-a1-m1-cM_6j3z-a1-m1-cm.pdb.gz
Full biological assembly
Download: 6j3z-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6j3y/1/1:M/1:m 6j40/1/1:M/1:m 6jlu/1/1:M/1:m 7vd5/1/1:M/1:m

[Back to Home]