6j4k/1/1:B/1:A

Sequences
>6j4k-a1-m1-cB (length=58) [Search sequence]
GKARMRWTPELHEAFVEAVNSLGGSERATPKGVLKIMKVEGLTIYHVKSHLQKYRTAR
>6j4k-a1-m1-cA (length=60) [Search sequence]
GKARMRWTPELHEAFVEAVNSLGGSERATPKGVLKIMKVEGLTIYHVKSHLQKYRTARYR
Structure information
PDB ID 6j4k (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural basis for the target DNA recognition and binding by the MYB domain of phosphate starvation response 1
Assembly ID 1
Resolution 1.58Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 35
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q94CL7 Q94CL7
Species 3702 (Arabidopsis thaliana) 3702 (Arabidopsis thaliana)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6j4k-a1-m1-cB_6j4k-a1-m1-cA.pdb.gz
Full biological assembly
Download: 6j4k-assembly1.cif.gz

[Back to Home]