6j4k/1/1:B/1:A

Sequences

>6j4k-a1-m1-cB (length=58) [Search sequence]

GKARMRWTPELHEAFVEAVNSLGGSERATPKGVLKIMKVEGLTIYHVKSHLQKYRTAR

>6j4k-a1-m1-cA (length=60) [Search sequence]

GKARMRWTPELHEAFVEAVNSLGGSERATPKGVLKIMKVEGLTIYHVKSHLQKYRTARYR

Structure information

PDB ID	6j4k (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural basis for the target DNA recognition and binding by the MYB domain of phosphate starvation response 1
Assembly ID	1
Resolution	1.58Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	35
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q94CL7	Q94CL7
Species	3702 (Arabidopsis thaliana)	3702 (Arabidopsis thaliana)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 6j4k-a1-m1-cB_6j4k-a1-m1-cA.pdb.gz

Full biological assembly Download: 6j4k-assembly1.cif.gz