6jn2/1/1:A/4:A

Sequences
>6jn2-a1-m1-cA (length=67) [Search sequence]
SIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLL
NAQLSVP
>6jn2-a1-m4-cA (length=67) [Search sequence]
SIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLL
NAQLSVP
Structure information
PDB ID 6jn2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the coiled-coil domains of human DOT1L in complex with AF10
Assembly ID 1
Resolution 3.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 4
Chain ID A A
UniProt accession P55197 P55197
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6jn2-a1-m1-cA_6jn2-a1-m4-cA.pdb.gz
Full biological assembly
Download: 6jn2-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 6cko/1/1:A/4:B 6cko/1/2:A/3:B
  • 6jn2/1/3:A/4:A 6jn2/1/1:A/2:A
  • 6jn2/1/2:A/4:A 6jn2/1/1:A/3:A
  • [Back to Home]