6kxv/1/1:A/1:E

Sequences

>6kxv-a1-m1-cA (length=94) [Search sequence]

RWRPGTCAIREIRKFQKSTSLLIQCAPFQRLVREVSSAQKEGLRFQSSAIMALQEATEAY IVSLMADTNLACIHAKRVTIQPKDIQLALRLRGE

>6kxv-a1-m1-cE (length=95) [Search sequence]

RWRPGTCAIREIRKFQKSTSLLIQCAPFQRLVREVSSAQKEGLRFQSSAIMALQEATEAY IVSLMADTNLACIHAKRVTIQPKDIQLALRLRGER

Structure information

PDB ID	6kxv (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a nucleosome containing Leishmania histone H3
Assembly ID	1
Resolution	3.63Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	37
Sequence identity between the two chains	1.0
PubMed citation	31722422

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	E
UniProt accession	Q4QHB5	Q4QHB5
Species	5664 (Leishmania major)	5664 (Leishmania major)
Function annotation	BioLiP:6kxvA	BioLiP:6kxvE

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6kxv-a1-m1-cA_6kxv-a1-m1-cE.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6kxv-assembly1.cif.gz