6kyt/1/1:J/1:K

Sequences

>6kyt-a1-m1-cJ (length=111) [Search sequence]

DLMMRRGEIWQVDLDPNQRPAVVVSNDRANATATRLGVITVVPVTSNIAKVYPFQVLLSA TTTGLQVDCKAQAEQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS

>6kyt-a1-m1-cK (length=117) [Search sequence]

DLMMRRGEIWQVDLDPARANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPF QVLLSATTTGLQVDCKAQAEQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS

Structure information

PDB ID	6kyt (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The structure of the M. tb toxin MazEF-mt1 complex
Assembly ID	1
Resolution	2.00101Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	68
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	J	K
UniProt accession	P71650	P71650
Species	83332 (Mycobacterium tuberculosis H37Rv)	83332 (Mycobacterium tuberculosis H37Rv)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6kyt-a1-m1-cJ_6kyt-a1-m1-cK.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6kyt-assembly1.cif.gz