6l00/1/2:A/4:A

Sequences
>6l00-a1-m2-cA (length=70) [Search sequence]
MFIYYKRTKQGSTEQWFVIGGKRIYLPTMTYVNEANDLIKRYGGNTNVTTYNHDNFGLKM
MEAALPQVKV
>6l00-a1-m4-cA (length=70) [Search sequence]
MFIYYKRTKQGSTEQWFVIGGKRIYLPTMTYVNEANDLIKRYGGNTNVTTYNHDNFGLKM
MEAALPQVKV
Structure information
PDB ID 6l00 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the cell-wall binding domain (CBD) of endolysin LysIME-EF1
Assembly ID 1
Resolution 1.75Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 43
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 4
Chain ID A A
UniProt accession S5MRN1 S5MRN1
Species 1351735 (Enterococcus phage IMEEF1) 1351735 (Enterococcus phage IMEEF1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6l00-a1-m2-cA_6l00-a1-m4-cA.pdb.gz
Full biological assembly
Download: 6l00-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6ist/1/1:A/1:B 6ist/1/1:A/1:C 6l00/1/1:A/3:A 6l00/1/1:A/4:A 6l00/1/2:A/3:A
Other dimers with similar sequences but different poses
  • 6ist/1/1:D/1:C 6ist/1/1:B/1:D
    		•

    [Back to Home]