6l6l/1/1:B/1:A

Sequences

>6l6l-a1-m1-cB (length=84) [Search sequence]

LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQ KCLAVGMVKEVVRTDSLKGRRGRL

>6l6l-a1-m1-cA (length=85) [Search sequence]

LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQ KCLAVGMVKEVVRTDSLKGRRGRLP

Structure information

PDB ID	6l6l (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural basis of NR4A2 homodimers binding to selective Nur-responsive elements
Assembly ID	1
Resolution	2.781Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	12
Sequence identity between the two chains	1.0
PubMed citation	31723028

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P43354	P43354
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:6l6lB	BioLiP:6l6lA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6l6l-a1-m1-cB_6l6l-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6l6l-assembly1.cif.gz