6lb3/3/1:D/1:C

Sequences
>6lb3-a3-m1-cD (length=92) [Search sequence]
MRPIHPGEILRDEFLMEFDISPAALARALKVSAPTVNDIVREQRGISADMAIRLGRYFDT
SAQFWMNLQSEYSLATAYAANGKQIEHEIEPL
>6lb3-a3-m1-cC (length=93) [Search sequence]
GMRPIHPGEILRDEFLMEFDISPAALARALKVSAPTVNDIVREQRGISADMAIRLGRYFD
TSAQFWMNLQSEYSLATAYAANGKQIEHEIEPL
Structure information
PDB ID 6lb3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of PA4674 in complex with its operator DNA (18bp) from Pseudomonas aeruginosa
Assembly ID 3
Resolution 2.497Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 91
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession Q9HVC1 Q9HVC1
Species 208964 (Pseudomonas aeruginosa PAO1) 208964 (Pseudomonas aeruginosa PAO1)
Function annotation BioLiP:6lb3D BioLiP:6lb3C
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6lb3-a3-m1-cD_6lb3-a3-m1-cC.pdb.gz
Full biological assembly
Download: 6lb3-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6jpi/1/1:A/1:B 6jpi/1/1:C/1:D 6lb3/2/1:A/1:B 6lb3/2/1:G/1:H 6lb3/3/1:E/1:F 7csv/1/1:B/1:A 7csw/1/1:A/1:B 7csy/1/1:A/1:B 7csy/1/1:C/1:D

[Back to Home]