6lcq/1/1:A/1:B

Sequences
>6lcq-a1-m1-cA (length=54) [Search sequence]
GPLGSRHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGLERKCFCKKVC
>6lcq-a1-m1-cB (length=54) [Search sequence]
GPLGSRHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGLERKCFCKKVC
Structure information
PDB ID 6lcq (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of rice defensin OsAFP1
Assembly ID 1
Resolution 1.62Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
PubMed citation 32192842
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q6K209 Q6K209
Species 4530 (Oryza sativa) 4530 (Oryza sativa)
Function annotation BioLiP:6lcqA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6lcq-a1-m1-cA_6lcq-a1-m1-cB.pdb.gz
Full biological assembly
Download: 6lcq-assembly1.cif.gz

[Back to Home]