6lm1/1/1:B/1:C

Sequences

>6lm1-a1-m1-cB (length=226) [Search sequence]

GMTQLALIGLWIGFIGMVIGAVIFGQKAVAMRRKEGMEFPLKSFFIVLWAGALYLTMILG
ETVTPVQTVFWGRYVDWVVTTPVLLLDLGVLAGLRPKLIAGVIAADIFMILTGLVATLEA
PPTSYLWYIISCGAFIAILASLLTEFTASAARRNVRVNNLFLKLRNYLIVLWICYPIVWL
LGAEAFKIIPTGVEVVIYAIIDIAAKVGFGLILTSAAPEILAQASN

>6lm1-a1-m1-cC (length=226) [Search sequence]

Structure information

PDB ID	6lm1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of cyanorhodopsin (CyR) N4075R from cyanobacteria Tolypothrix sp. NIES-4075
Assembly ID	1
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	15
Sequence identity between the two chains	1.0
PubMed citation	33028840

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	A0A218QMM7	A0A218QMM7
Species	2005459 (Tolypothrix sp. NIES-4075)	2005459 (Tolypothrix sp. NIES-4075)
Function annotation	BioLiP:6lm1B	BioLiP:6lm1C

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	6lm1-a1-m1-cB_6lm1-a1-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	6lm1-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6lm1/1/1:A/1:B 6lm1/1/1:A/1:C