6lmj/1/1:B/1:A

Sequences
>6lmj-a1-m1-cB (length=98) [Search sequence]
PTITKQELYSLVAADTQLNKALIERIFTSQQKIIQNALKHNQEVIIPPGIKFTVVTVKAK
PARQGHNPATGEPIQIKAKPEHKAVKIRALKPVHDMLN
>6lmj-a1-m1-cA (length=99) [Search sequence]
KPTITKQELYSLVAADTQLNKALIERIFTSQQKIIQNALKHNQEVIIPPGIKFTVVTVKA
KPARQGHNPATGEPIQIKAKPEHKAVKIRALKPVHDMLN
Structure information
PDB ID 6lmj (database links: RCSB PDB PDBe PDBj PDBsum)
Title ASFV pA104R in complex with double-strand DNA
Assembly ID 1
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 134
Sequence identity between the two chains 1.0
PubMed citation 32358196
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P68742 P68742
Species 10497 (African swine fever virus) 10497 (African swine fever virus)
Function annotation BioLiP:6lmjB BioLiP:6lmjA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6lmj-a1-m1-cB_6lmj-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6lmj-assembly1.cif.gz
Similar dimers

[Back to Home]