6lp3/1/1:C/1:F

Sequences
>6lp3-a1-m1-cC (length=43) [Search sequence]
YDEIFTENIKLKLQVQEYETEIESLEKVIDMLQKNREASLEVV
>6lp3-a1-m1-cF (length=43) [Search sequence]
YDEIFTENIKLKLQVQEYETEIESLEKVIDMLQKNREASLEVV
Structure information
PDB ID 6lp3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural basis and functional analysis epo1-bem3p complex for bud growth
Assembly ID 1
Resolution 3.547Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 44
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C F
UniProt accession P32873 P32873
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6lp3-a1-m1-cC_6lp3-a1-m1-cF.pdb.gz
Full biological assembly
Download: 6lp3-assembly1.cif.gz

[Back to Home]