6m1v/1/2:A/3:A

Sequences

>6m1v-a1-m2-cA (length=91) [Search sequence]

MENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLLVPRISGINA SVVNIQKEIDRLNEVAKNLNESLIDLQELHH

>6m1v-a1-m3-cA (length=91) [Search sequence]

MENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLLVPRISGINA SVVNIQKEIDRLNEVAKNLNESLIDLQELHH

Structure information

PDB ID	6m1v (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of post fusion core of 2019-nCoV S2 subunit
Assembly ID	1
Resolution	1.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	97
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	3
Chain ID	A	A
UniProt accession	P0DTC2	P0DTC2
Species	2697049 (Severe acute respiratory syndrome coronavirus 2)	2697049 (Severe acute respiratory syndrome coronavirus 2)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6m1v-a1-m2-cA_6m1v-a1-m3-cA.pdb.gz

Full biological assembly Download: 6m1v-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6m1v/1/1:A/2:A 6m1v/1/1:A/3:A