6m28/1/1:A/1:B

Sequences
>6m28-a1-m1-cA (length=118) [Search sequence]
MEALVLVGHGSRLPYSKELLVKLAEKVKERNLFPIVEIGLMEFSEPTIPQAVKKAIEQGA
KRIIVVPVFLAHGIHTTRDIPRLLGLIEIPEDVEIIYREPIGADDRIVDIIIDRAFGR
>6m28-a1-m1-cB (length=118) [Search sequence]
MEALVLVGHGSRLPYSKELLVKLAEKVKERNLFPIVEIGLMEFSEPTIPQAVKKAIEQGA
KRIIVVPVFLAHGIHTTRDIPRLLGLIEIPEDVEIIYREPIGADDRIVDIIIDRAFGR
Structure information
PDB ID 6m28 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Sirohydrochlorin nickelochelatase CfbA in complex with Co2+
Assembly ID 1
Resolution 3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 124
Sequence identity between the two chains 1.0
PubMed citation 34163982
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q58380 Q58380
Species 243232 (Methanocaldococcus jannaschii DSM 2661) 243232 (Methanocaldococcus jannaschii DSM 2661)
Function annotation BioLiP:6m28A BioLiP:6m28B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6m28-a1-m1-cA_6m28-a1-m1-cB.pdb.gz
Full biological assembly
Download: 6m28-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6m25/1/1:A/1:B 6m26/1/1:A/1:B 6m27/1/1:A/1:B 6m29/1/1:A/1:B 6m2a/1/1:A/1:B 6m2e/1/1:A/1:B 6m2f/1/1:A/1:B 6m2g/1/1:A/1:B 6m2h/1/1:A/1:B

[Back to Home]