6m36/1/1:E/1:G

Sequences

>6m36-a1-m1-cE (length=100) [Search sequence]

DYIEMKVPAQPEYVGIIRLTLSGVASRMGYTYDEIEDLKIAVSEACTNAVQGEVSIRFGV FEDRLEVIVADGLGLYLMETLMDEVRVQNGVTVAMTKYLN

>6m36-a1-m1-cG (length=104) [Search sequence]

DYIEMKVPAQPEYVGIIRLTLSGVASRMGYTYDEIEDLKIAVSEACTNAVQHAYGEVSIR FGVFEDRLEVIVADGLGLYLMETLMDEVRVQNHGVTVAMTKYLN

Structure information

PDB ID	6m36 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of B. subtilis RsbV/RsbW complex in the monoclinic crystal form
Assembly ID	1
Resolution	3.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	49
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	G
UniProt accession	P17904	P17904
Species	224308 (Bacillus subtilis subsp. subtilis str. 168)	224308 (Bacillus subtilis subsp. subtilis str. 168)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6m36-a1-m1-cE_6m36-a1-m1-cG.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6m36-assembly1.cif.gz