6m36/2/1:J/1:P

Sequences
>6m36-a2-m1-cJ (length=100) [Search sequence]
NINVDVKQNENDIQVNIAGEIDVYSAPVLREKLVPLAEQGADLRICLKDVSYMDSTGLGV
FVGTFKMVKKQGGSLKLENLSERLIRLFDITGLKDIIDIS
>6m36-a2-m1-cP (length=100) [Search sequence]
NINVDVKQNENDIQVNIAGEIDVYSAPVLREKLVPLAEQGADLRICLKDVSYMDSTGLGV
FVGTFKMVKKQGGSLKLENLSERLIRLFDITGLKDIIDIS
Structure information
PDB ID 6m36 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of B. subtilis RsbV/RsbW complex in the monoclinic crystal form
Assembly ID 2
Resolution 3.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 16
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID J P
UniProt accession P17903 P17903
Species 224308 (Bacillus subtilis subsp. subtilis str. 168) 224308 (Bacillus subtilis subsp. subtilis str. 168)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6m36-a2-m1-cJ_6m36-a2-m1-cP.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6m36-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6m36/1/1:B/1:H 6m36/1/1:F/1:D 6m36/2/1:L/1:N

[Back to Home]