6m37/1/2:A/2:C

Sequences
>6m37-a1-m2-cA (length=113) [Search sequence]
ADYIEMKVPAQPEYVGIIRLTLSGVASRMGYTYDEIEDLKIAVSEACTNAVQHAYKEDKN
GEVSIRFGVFEDRLEVIVADEGGLGLYLMETLMDEVRVQNHSGVTVAMTKYLN
>6m37-a1-m2-cC (length=115) [Search sequence]
DYIEMKVPAQPEYVGIIRLTLSGVASRMGYTYDEIEDLKIAVSEACTNAVQHAYKEDKNG
EVSIRFGVFEDRLEVIVADELSEGGLGLYLMETLMDEVRVQNHSGVTVAMTKYLN
Structure information
PDB ID 6m37 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of B. subtilis RsbV/RsbW complex in the hexagonal crystal form
Assembly ID 1
Resolution 3.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 52
Sequence identity between the two chains 0.991
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A C
UniProt accession P17904 P17904
Species 224308 (Bacillus subtilis subsp. subtilis str. 168) 224308 (Bacillus subtilis subsp. subtilis str. 168)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6m37-a1-m2-cA_6m37-a1-m2-cC.pdb.gz
Full biological assembly
Download: 6m37-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6m36/1/1:A/1:C 6m36/2/1:K/1:I 6m36/2/1:O/1:M 6m37/1/1:A/1:C

[Back to Home]